Zu "GeneID 397208" wurden 8 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
NEU
GM-CSF, Swine
Artikelnummer: CR-C03018-100UG
Sequence: APTRPPSPVT RPWQHVDAIK EALSLLNNSN DTAAVMNETV DVVCEMFDPQ EPTCVQTRLN LYKQGLRGSL TRLKSPLTLL AKHYEQHCPL ETSCETQSIT FKSFKDSLNK FLFTIPFDCW with polyhistidine tag at the N-terminus Endotoxin level: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Cytokine that stimulates the growth and...
| Schlagworte: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor |
| Anwendung: | Cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | swine |
ab 120,00 €
Pig GM-CSF recombinant protein (Active)
Artikelnummer: ARG70212.20
Protein function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. [The UniProt Consortium]
| Schlagworte: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor |
| Anwendung: | SDS-PAGE, cell culture |
| Ursprungsart: | swine |
ab 336,00 €
GM-CSF protein(N-His)(active) (recombinant swine)
Artikelnummer: E-PKSS000024.5
Activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <3 ng/mL. Sequence: MWLQNLLLLGTVVCSISAPTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK. Fusion tag: N-His Endotoxin: Please contact us for...
| Schlagworte: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor, Recombinant Swine GM-CSF... |
| Anwendung: | Active, cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | swine |
| MW: | 17.08 kD |
234,00 €
GM-CSF, swine recombinant (rpoGM-CSF)
Artikelnummer: RP0940S-025
Produced in Yeast. Amino acid sequence: APTRPPSPVT RPWQHVDAIK EALSLLNNSN DTAAVMNETV DVVCEMFDPQ EPTCVQTRLN LYKQGLRGSL TRLKSPLTLL AKHYEQHCPL TEETSCETQS ITFKSFKDSL NKFLFTIPFD CWGPVKK (127).
| Schlagworte: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor |
| Anwendung: | Bioassays |
| Exprimiert in: | Yeast |
| Ursprungsart: | swine |
| MW: | 14,4 kD |
ab 206,00 €
GMCSF Porcine
Artikelnummer: ABE-32-6381-100
Source: Escherichia Coli.Sterile Filtered White lyophilized (freeze-dried) powder.GMCSF is a cytokine that controls the production, differentiation, and function of granulocytes and macrophages. The active form of GMCSF is found extracellularly as a homodimer. GMCSF has been localized to a cluster of related genes...
| Anwendung: | FA |
| Exprimiert in: | E.coli |
| Ursprungsart: | swine |
ab 1.259,00 €
GMCSF Porcine, His
Artikelnummer: ABE-32-6382-10
Source: Escherichia Coli.Sterile Filtered colorless solution.The hematopoietic growth factor GM-CSF or granulocyte macrophage colony-stimulating factor, stimulates the development of neutrophils & macrophages, enhance proliferation and development of early erythroid megakaryocytic & eosinophilic progenitor cells....
| Anwendung: | FA |
| Exprimiert in: | E.coli |
| Ursprungsart: | swine |
ab 438,00 €
Porcine GM-CSF ELISA kit
Artikelnummer: ARG82961.96
Protein function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. [The UniProt Consortium]
| Schlagworte: | CSF, CSF, CSF2, GM-CSF, GM-CSF, Colony-stimulating factor, Colony-stimulating factor, Granulocyte-macrophage... |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | swine |
880,00 €
GM-CSF protein(N-His)(active) (recombinant swine)
Artikelnummer: E-PKSS000024.20
Activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <3 ng/mL. Sequence: MWLQNLLLLGTVVCSISAPTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK. Fusion tag: N-His Endotoxin: Please contact us for...
| Schlagworte: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor, Recombinant Swine GM-CSF... |
| Anwendung: | Active, Cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | swine |
| MW: | 17.08 kD |
588,00 €